Dataset for protein Bmf of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************. *  .  : *. *         *  :*..                                 
GVMLPCGVTEEPQRLFYgnAgyrlplpAsfPavlpigeqpPegqWqhraevqiarklqciadqfhrlhvqqhqqnrnrvw
                 ap epksrvv dp l-----paq cfe rr---------------------------------

       170       180    
....:....|....:....|....
              *::*.*.   
wqillflhnlalngEenRnGagpr
-------------- qe g p---
© 1998-2018