Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 eegkspvrsarrrgppaqrsssg---g-rcmqcepqigllvheqssaqlvsalsslpstksr drgpsrlvgptsssvh
   epkgsknvsglatrnpqpgt ytt-v- dia  gd fk aagrppk -r  ladsfsalv plpledaspvvrwrrc
     earglrqec dq lc eq  rlwta               hlka g      lcp    kgmhd  hlramther
     c f gh a  c  fa      ae                                    ac g   a g l ece
       c c                                                       a       f      

        90       100       110       120       130       140       150       160
qwaqeygsswtlsaydlwpqyqslvvmnqtsssttlwqsrknpimlrlpqpryhreptahptwrlrpggl rlrswr   
asslwpwrvtrsmrqwnnldrprrrqgmlqrprssirlg h efl lcgnhqn lale glpaadpieea pekqrq   
 rra atppldkehhsag ckmqelleeemllpgfdqga       faa ag  f ka efe   gfa   a gllp   
 p       ga adee e  gllageaaaeghlec ne                e e   d            fg g   
              d  d  aee e    ceaka                                              
                     aa      aa g                                               

       170       180       190       200       210     
evde rglqcgvalgeavsvspvwlaqtwtwwtlgrhevspasvggqtkplsrsr
           tttlwpsvwqwqqsnknpvppqqvlfhslllqn lmnqiffg k
           rrqirgqqppsllqgfafrgnnil    a dle eahed d   
           inkhmdlkdfqhgff    d d              e       
            iifh ihc  faac                     a       
            hfec  g   e                                
© 1998-2019