Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------makqpsdvsse-----cdregrqlqpaerppqlrpgaptslqtepqg-----h-g------------
mpikkgmfqipefepseqeas-aaerglgpspa-drpsdsgkhhrqaspllwdashqqe-npegn-g-egrwyssveerg
  g favksarpsp-rv rrgv--ttwvp----d---gl-l-ethstklvssapgvlarqptsssqhvgteveywtwtiw
      rgpcqlh-tqg ppftgr a tarqqsapvi--r-s-sggqaas l  lrylhsllqqvpvrrsaecqpsr ss
       cn  acrgma a creg      alc ggf mqshyq ak  r k  dlfgg hedcplsalr   gapq  e
              ee               i  f    ldgaa  e  n     d       aa    q     a    
              c                c       e a             a             a          
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------s----------------------------l---s-----sf--drspapmscdkstqtpsppcqafn
rstsypadscphg-pqgplappaspgpfatrsplfifmrrss-lsr-ssgyf--dt------------------------
hqsrrslttledaglrvlvsettgtstspppvlyrlvrypckvrrmpdefvpgpngyptqrsrwrraglsrscwwarvlw
dhlnpm rmsnsqyqtrtsrsqrasrrliwgnqwqgqllnve ttlhvtwrdrvkvsarlvvlvtttvyrqrpsstglqs
a ella klqlgp mppsqqnlqrrqqhgral snai glrt pqggrrpfyhna p l ttarpprqwplkeqkslgcr
  def  ghecee eemrppafl qk c e   ka    glp kee qalemece l g pg pghlargigafaqe aq
   ad  ed aad a leag ek ha               g ha  l eal    a a l  gfa  m    a pa  p
                e  e dd e                      f            k  c           f   k
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210         
....:....|....:....|....:....|....:....|....:....|....:....
                                                           
hylsam---------asrrq--p------------------------------------
------qiatkssli--q--av-asmrpliriaqelrrigdefnayyarrlskppasst
wwwpwvde rglqcgvg-hsvealpspwegfrrvwwqlylhlhsqdtnqlqnrnlsgpr
tpratt         sdlgeelvvdqggqtqnptrcmil fh  lalegenhllgd   
sltdrs         pawvrsaqsqvwskp lnpg d             meedf    
qh  pn         nvimhrmlwatlqfn  fl                 a       
a   el         lrfl hihd lhlca   f                         
               inei ddg  ae                                
               giaf                                        
               c  e                                        
                  d                                        
                  a                                        
© 1998-2019