Dataset for protein classical BH3-containing proteins of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                             .                  
----------makqpsdvssecdregrqlq---------------paerpp------qlrpgaptslqtepqqnpegnhg
mmpimfqipefepseqedvwaaeaglgpsprqsdgfvpsmqlsytagds-sdsgkhhrqassllwdashqqeg-------
 eegkspvrsarrrgpraqrsssd--tg-rcmqcepqigllvheqsspklvra lsl---kasslamprglt-ptsssrh
   epkgrkn--meatpnpe lt yvlwv- dia  gd fk aagrpkge-      pcta r kv glfhsstvqcpls
     cafglrsgc cqclc gq dtfeta               hlaa        gaq    gl dgdahprlpwvfl
       c ghqa      a     ra                   e            p    d  ad   eqamvr  
                                                                         l d a  
                                                                         a      
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ge----------------------------a---------p----------lsr--s--f----drspapmscd-----k
--agavetrsrlysgdscphgspqgplapp-spgpfatrs-lfifmrrssl---ss-gy-sfdt--l-r-----mrpeva
rg        qhwyypeiwsqderpasdsdsayqtlrsspqvlwvtspygvvlnlqpvwyalvryg-w-tevpp    i-
ev         eswtthwtrptslmtetrspqtlrslqanlttvssqqwrrtyltmrstsvnsqswrtqrstan     r
ap         cqpsratsgelrgnhdqlnlfsesrgpel srsrpllrqgqvkrlmrrltdpllsfrpelpst     q
 l         af lq gge gle e eemkdraqadm e qqhkeeihaenkepklllcp hgkh elagnks      
              a   ea e      ae  k    l a naggac g  ke ciadf g afg  ae ahfq      
                  c             e    a   a da a c  e   f  e     a      e        
                                                       c                        
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
                                                                        
stqtpsppcqafnhylsam-----------------------------------------------------
-------------------caarsvrplaswrqevpassrweiriaqelrrigdehnayyarrqskppsgpr
avprgrrrsygwwrvpawlwkrtqsslsvarlealvvdmspqnfnrvwwqlylhlfsqdtnqlnnrngd   
vrvlvqqqgssrttsyqswqi nlpqgpsvlslterwqtlqlg  ftg dil fh  lalegemhldfa   
plsirmhltkeqrqhwprvge gkllcitrgqhsrqsprhmga                    le       
laleqg ipg lpcfr prdd aggaaginqirrqmplqegf                              
i a le ake  ka f ef    a    giph liinflc                                
g    a   d                   dig g hda                                  
                              ff d g                                    
                              ee   a                                    
                               d                                        
                               a                                        
© 1998-2019