Dataset for protein Bad of organism Macaca mulatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                               r   gpswtsghhenpp
                                                               a    ap   ed dada

        90       100       110       120       130       140       150       160
              .  . .               :*. :   :       .                            
-rtql---lrvsvpstlsqg----pnlwaaqry--e ktlpv-wrdrvevparlrslrrrlqwsqpspwqrvfrswwprt
 kmleeegapmlagaed eaqh e         nv   a glt a gpagl g ppapphk mglkpfkfglcqaprdpn
 glea                                             a a kg ggaa l    a aaaak      

       170       180  
  . .  . .            
 h laahdssplpqc  lam
        a p           
© 1998-2019