Dataset for protein classical BH3-containing proteins of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 sgvrpisrdtlmetlly qpgkvlt-g-e cr---rssstwvpvtd-elpddlfr-edge-rsqwyvvswadlfadsla
                   mlfekgskem-  pcveqaga gtngqav-qypskilm----t--vksnevavsedttqyl
                   ik   ar rac  qtrra     paclirtpaekgagkqqqyssrsdqgap tmvrhsnrs
                           ne    fpg          g qm  fe danldleppkalf g plsh empr
                                   a            gd   d   ma f  ma e  d fkcg  lhe
                                                               g       ce a  ad 
                                                               a        a     a 

        90       100       110       120       130       140       150       160
arv     qlevgmrversawlsevrsasrrlafiyryqykllrrsqlwppthctgpglrptsqedkatqtlgwagps-q
dql     le e aqmsvpsvrgrsqmhplnmwddqnqnvepktlpvt vlgftcp tptvrvtttgyryktsstwwatg
pkt      a    pepplrtdrqigh l g  a ldamrcr dvgrs rdsvkga a kglrrimrww  sqerrvvse
l m           ealaeqqa  aaa e         gddi aqele a  pe       agnhlqmg  cn qatqra
f d             a  pf                       m d      a        egak f    k i rf  
                    e                                                   f f le  

       170       180       190       200       210       220       230       240
vrlstswtgepqllfynlvapllplvsgglpqiqkgemppee eqglwlvqrrtt qqyesslhrnwvqqlfkplswvww
wmrrcgv----trwwllnlgykscvsvsselpalicce        krfgl frk hlfahrhsqlth lnswlrnssts
rwqenlgsvvyrsvmrrptewtessgtqq hn  f           ga ff  cg dc  eq gidle emhqdperl  
ppp   eqrqslqk gg pvsitrirplp al                             h  cah   hee fd    
mhd    klnq  i d  irlgmhaqgef                                          a   a    
l a     hl        gnkegerld                                                     
        d         dlidfd a                                                      
                   if a                                                         

       250       260   
sillflhnla ngeenrngagp 
© 1998-2019