Dataset for protein classical BH3-containing proteins of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------makqPsdvss----------ecdregrqlqpaerppqlrpgaptslqtepqgnp
mfqipefepseqedsssaerglgpspa-dr---sgkhhrqapgllw-ashqqevptssshhggt---ssleerglsr---
 sgvrpisrdtlmetlly qpgkvlt-g-e cr---rssstwvpvtd-elpddlfr-edge-rsqwyvvswadlfadsla
                   mlfekgskem-  pcveqaga gtngqav-qypskilm----t--vksnevavsedttqyl
                   ik   ar rac  qtrra     paclirtpaekgagkqqqyssrsdqgap tmvrhsnrs
                           ne    fpg          g qm  fe danldleppkalf g plsh empr
                                   a            gd   d   ma f  ma e  d fkcg  lhe
                                                               g       ce a  ad 
                                                               a        a     a 
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
eg----------------------------------------rs-l--f-------------------drspapmscdks
--nacigdemdaslhggegdscphgspqgplappaspgpfat--p-fi-mrrssllsrsssgyfsfdt----------q-
arv     qlevgmrversawlsevrsasrrlafiyryqykllrrsqlwppthctgpglrptsqedkatqtlgwagps-q
dql     le e aqmsvpsvrgrsqmhplnmwddqnqnvepktlpvt vlgftcp tptvrvtttgyryktsstwwatg
pkt      a    pepplrtdrqigh l g  a ldamrcr dvgrs rdsvkga a kglrrimrww  sqerrvvse
l m           ealaeqqa  aaa e         gddi aqele a  pe       agnhlqmg  cn qatqra
f d             a  pf                       m d      a        egak f    k i rf  
                    e                                                   f f le  
                                                                            ac  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tqtpsppcqafnhylsamasrrqaepad----------------------------------------------------
-------resv-----------lpl---mptvlpprfqwrrgqwrhrpeiriaqelrrigdefnayyarrvflnnyqaae
vrlstswtgepqllfynlvapl--avssglpqiqkgemppee eqglwlvlrrtt qqyehrhhrvwwqllwkpsssvww
wmrrcgv----trwwllnlgykse-svgselpalicce        krigq frk hlfaeqlsqntvpqnsqlrnrst 
rwqenlgsvvyrsvmrrptvwiecvggqq hn  f           ggfff  cg dc   h relqe  mqedpd    
ppp   eqrqslqk gg prsgtssttlp al               a a              cdh   hh ala    
mhd    klnq  i d  inlemrirpef                                         ee  f     
l a     hl        glkdghrqd                                            a        
        d          ii fd l                                                      
                   ef d  a                                                      
                    e a                                                         

       250       260   
....:....|....:....|...
                       
-----------------------
dhpqmvilrllryivrlvwrmhr
qillflhnla ngeenrngagp 
                       
                       
                       
                       
                       
                       
                       
                       
© 1998-2019