Dataset for protein classical BH3-containing proteins of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                      :                         
--------------------------makqpsdvsse----------cdregrqLqpaerp--pqlrpgapts------l
mfqirefepseqedsssaerglgpspagdrsapsraqslldwvpgtqhrqapglvwdlthqcgqeqptssshhggtawys
 epspcvseltddvfqpedmppksqrksal---tgkhasqtvtccqi-plsrl-ilavskylnerplrtmqgd  r   k
 sgv pi rd lmetlly gegekatgns- cqlf-- gaegeaa as-----n fmrqdl  tggklrveet  a   -
                   qlf vls e-e   --rr e a      rgsq sk ngql c  lsevkpc df      p
                   ik   g  rec   fpga          l pf pg gfe     gid dl  se      n
                                                    f            a  f   a      g
                                                    d                          f
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qtepqgnpegnhgge--------pq-p--ppa-pg-----s------------------------drspapmscd-----
avqtr----------gdscphgs--g-la---s--pfatr-plfifmrrssllsrsssgyfsfdt----------tttgy
p--elepsspvqavmlpcgveeeaslrfyalpelssyvvartplwaiydynvklktlpvtwvpgfatlrtltvrvrrprw
-sw--shadsssvrtarwayttdeirlvtvsstytqvsssqqnel aq qmrei rvlrs rdsvtsr rarparnimqm
vpsftqdhrqyalklsqv rsmqvgwersrndqrresrrhplgaa     gdd  dmgle m rpkgp q kglgmhlei
sllcs repnpr ereci dqlg  m qpgg lnkrrqp efe            a  d  a   e a   e  egak f
lgg m l  mlp a      li   a mmed gealplm d                                       
 d  k a  ak          a     el   fd  geh                                         
          d                ae   a   e d                                         
                                    a                                           
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
kstqtpsppcqafnhylsamasr-----------l-a-------------------------------------------
rrs--srsw-r--------r---llvllllqflrrq-epadmrpeiriaqelrrigdefnayyarrvglnpyqaaedhpq
-q-pa-qr-v-ewqsrylr-gvvk qciadlahl-aesvgsstwnwfwwti llyhnlhsqveeqlnfkpns        
w-rtsw--vtvvyrrwwglqvrw           mpsqsvgllrirvrfmg dfl hharngtwp mwpgsr        
vnpsrlttlrsspwpptfgnrqt           ihlltsqqhqlpl c          ledqqn lsadfd        
tlmrqekqiikql linevlpns           gevaqpr nlflk                 e gh a          
qilin fgcggl  k md  llp           esqvlhe eg g                    ee            
g khg aaaffg  d aa  iii           dghrge   c a                                  
  acf    ed   a     hgf           addied                                        
    e    a          ece              fa                                         
                     a                                                          

       250        
....:....|....:...
                  
------------------
mvilrllryivrlvwrmh
                  
                  
                  
                  
                  
                  
                  
                  
                  
© 1998-2018