Dataset for protein Bim of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQgnpegnhggegdscphgspqgplappaspgpfatrsplf
                                         ---------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          . ..*     . :*      : ** * :                          
ifmrrssllsrsssgyfsfdtDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMasrrqaepadmr------------
---------------------asrrqaepa mrpeiria elrrigde  a yarr---l-e------peiriaqelrri
                                                        vvw-e-vvvsslwigl ftg dly
                                                        griiddltg  tgfaf        
                                                         nfea ild               
                                                         ied  ag                

       170       180       190       200   
....:....|....:....|....:....|....:....|...
                                           
-------------------------------------------
gdefnayyarrvflnnyqaaedhpqmvilrllryivrlvwrmh
 hhhsqvtwqlnwkpss                          
    redqep ms dpd                          
           lh af                           
           ee                              
© 1998-2018