Dataset for protein classical BH3-containing proteins of organism Labrus bergylta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                 .. * :  .    . 
---------------------------------------------------d--maakftisdsesgsEeevkeeen-dq
mkcnnkcyhfirlvfvkkqsvpsrpyntvntsptvysshstrnkpstltvs-vt----------tgdg pdspsrdrhsw
                  mhricagpgrldgfgpaterdg egdipqtsrl nsggrn grt  me d  f pcpfkp
                                             mc ga                              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 : .:.    :. :    *    * .. :               .          :      :                 
ssaveephvpqrhsl-tlPelrlAgtgri----------rlnseshaytvsrdeelqargeeeagtpt------------
vtyfqslkcfdkrt-fqt --ar ssnymlpcgvaeeprsyfygnlpssplsprpftlvkdtqtssqsgqvmqhalqrmt
r p d ig e  g i h  gp   pgf          p dgd agfrlhf an e d aq epg e            
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    .  :  . .       * .*. :.*::                                 
--------------egapfrgrsksappalwaakkyGrqLrrmsDefdilldkgvrikggg-g---------------pk
eahgggpgtqqqygsspsqtsmrqrtavghsveesi lk qlig qy--------------g-srggcglvvesvvsq--
              helqli  e qq a dmq aa   d      nr  lwrmmkrvrsp                 e
                                                      eag h r                  a

       250       260       270       280       290
....:....|....:....|....:....|....:....|....:....|
                          .  :                    
sqefntqllqphvrcvlgs-lnvykwgyliliitlhssl-----------
----hsphw----------g-----ldwilysrlttrgnnhsqvrthrne
vhpnprksi lyptnqrnt pmwwrisaafslqgnenehiahenhr    
k mh qe    eh ml cq  lill      hlefdg fd gag      
© 1998-2019