Dataset for protein Bad of organism Labrus bergylta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                      **************************
-----------------------------------------------l---dvtMAAKFTISDSESGSEEEVKEEENDQS
mkcnnkcyhfirlvfvkkqsvicagygtvntfgpaysrdstenkist-tvs---                          
                                             mc gal                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
SAVEEPHVPQRHSLTLPELRLAGTGRIRLNSESHAYTVSRDEELQARGEEEAGTPTEGAPFRGRSKSAPPALWAAKKYGR
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************   *  . *               * .* .:::                 *.**:      .. 
QLRRMSDEFDILLDKGvriKggggGsrggcglvvesvvsqPksQefntqllqphvrcvlgslnvykWdYLiliitlhssl
                emk vrsp --------------- ak mhhsksw--------------- s  fshqetegen
                                                                                

       250 
....:....|.
           
-----------
nhhenhthrne
           
© 1998-2019