Dataset for protein classical BH3-containing proteins of organism Ictidomys tridecemlineatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------astpspvsspsg
mpragvfwkqyravrsgllrrppesaaaagpasgsrlpgsgvslpqvfitldpgaepwhmgipekalm-kqhaemerkqd
                                                           hdseaet iw----dgapecc
                                                                   s vh g-------
                                                                      f e       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
veg---kvvqpagrrpgwrpg-------wtqsqqtipq--p----d----g-glgp----d-pg----------------
r-epgrgqlg-eegprqtq-asllsadlfpt-mlqe-lsr-slqp-tssc-p----tsqg-r--pfatrsplfifvqtls
k -leddaf- -d-e--lh -       aa- lfdc efelqefelshcaegpqr spaeakat            rrs 
-     ---   - -  --         --  ---- -gn egeg rcph s    lapp s                  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                         .                                   *. 
--s-s-g--rptgvtqwparlscnnsgytltpp----asypagtplmeqsqeepaqmr-------pevwiaq----eLrr
pc-p-q-vpldc-hqrsqqtsfygkgtqrpsltrsrhshflsdmdsgrgppagqwphtgrsrsapanlqa-rrygrk qc
laglapslm---d-deealpmasdhaeagapeqcqafnql galahdlemeys sdf        --i-- -    v  s
 l r s gymvq th v      igd md cf dlql     mam s als    rv          -            
         fsf s                                                                  

       250       260       270       280       290       
....:....|....:....|....:....|....:....|....:....|....:..
:.: :                                 :                  
iadefnrly--------yqphtr----pqmrvlwqlllflrllwlrh---r------
msqqlhlyhprrvffrpm-qeqqvppanrnviwrlirciiqsvarnglen-dragpr
lg g egsfenkwlwnn-s--d-    ---------vtlshnwlsmadyr ls psq
     as r  mg p  raas-a    sac qssswtr  g pfd n gl gq    
                 a  g      r   e lpv                     
© 1998-2018