Dataset for protein classical BH3-containing proteins of organism Ictidomys tridecemlineatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------mastpspvaspsg
mpragvfwkqyravrsgllrrppesaaaagpasgsrlpgsgvslpqvfitldpgaepwhmgipekali-kqhaemsrkqd
                                                           hdseaet -wvhshdgepecc
                                                                   svqg gq  lrla
                                                                      f e       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
veg---kvvqpagrrpgwrpgwttsmqtipq----sqldssssrlqlgplphgdrpg-----------------------
riepgrgqlg-eegprqtq-aspq-lfqfaefepseee-cplaegg-f-staccg--pfatrsplfifvrrsslcglapg
k  leddaf- -d-e--lh -all adle--gn e--- -c-----q-q----a-hs                 lsrsss
c     ---   - -  --  --- ----      g m r-pqgsp a  app-s                         
                                   d g l fhd       gm m                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                    *        ::.
l------drwtatsssnsstqgvtppcsvts------------------sypagtplmeqsqeepaqmR-------pevw
-rrttqhqqsqqpm-pdkpsatpsltrqrhnepqrlfygnagyrlplpahflsdmdsgrgppagqwph grsrsapanlq
gppdsge-kap--l cahgg--ame--gafe              a sy qaralavd emeq lsdf        e i 
 yfsfdt ---  - -----  ---  ----                      v g l sla    sl          m 
                                                                                

       250       260       270       280       290       300    
....:....|....:....|....:....|....:....|....:....|....:....|....
  .                                          :                  
iaq----elrrisdefnryy--------yqqhqrpqmrvlwqlllflrllwlrh---r------
awrrygrk-qcmg-q-hlshprrvffnnm-pedqnrnviwrlirciiqsvarnglen-dragpr
     - ---a - eglf  kplprs-s---a---------vtlshnwlsmadyr ls psq
            -   ----   gaapptrvpt-sac qssswtr  g pfd n gl gq    
                            r agp r   e lpv                     
© 1998-2019