Dataset for protein Bim of organism Ictidomys tridecemlineatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------------------------------------
                                         gnpegegdrcphgspqgplappaspgpfatrsplfifvr

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 ***************************************************************
-----------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRESQAEPADMRPEIWIAQELRRIGDEFNLY
rssllsrsssgyfsfdt                                                               

       170       180       190     
....:....|....:....|....:....|....:
***********************************
YPRRVFFNNYQPEDRPQMVILRLLRCIIRLVWRMH
                                   
© 1998-2018