Dataset for protein Bad of organism Ictidomys tridecemlineatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MGIPEKALIASTHAPGARKSGKEGPGRKAVGPAGRRRGWHPAWTQSMFQIPEFEPSEQEDSSSAEGGLGPSPAGDRPGCG
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LAPGLPRDTGHQQWQATSSSNHGGAGATETRSRHSSYPADTDLDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSD
                                                                                

       170       180       190       200        
....:....|....:....|....:....|....:....|....:...
*******                    . * ** : *           
EFEGSFK--------------------vtFsQSwwlRn----------
       glprprsagtasqmrqssswtr i  pfd algrrgsapsq
© 1998-2018