Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 kfgmgsamfq------s-q-d      vt--e-lasadlglardgpr fplgravsssscaerlegaspag-a-sg--k
   mcpcpqacipever-e-t-      armr ksprmvq mg aqa  cqvp  a tavvytlc---pasas-t--lt-
        lsrprqpsgaamat       gtl lksekpf                   wlpcqittvl--llrgeahqp
         h vcpl avilmr       ep  argp na                   l    eqns-tmphldrrgpe
           g ma   cacs            h a k                          ke rgk a   le t
             g                    a                              ga g h      a r
                                                                 c             g

        90       100       110       120       130       140       150       160
atylcaltapqpttaaaggsrmrapdrlecrg k cvvad pspasdtersreepgaaglqlvsplqaslslarqh    
vrwat agvaim psg v dpledr sc  mr s arrlr  rwsq mremhnnitrpkklmapsmpvryvdverg    
spv d  pfrgl dl  d      f        h  l c   cvrr ddvhalagrlmq eg dqhctpvlpspde    
qmc    d  a  a   a                          hg        fdg    e  ma sl gfils     
gga                                         g          a     a      g eagaa     

       170       180       190       200       210       220       230       240
                                 vslilnsplstrvgyaqarkqvmpqwtsrehavwvsppnv qssla 
                                 rrgchhrkspryspsrpqpvidgvgtlllte svqmelkp lphh  
                                 hleagggwrg mrk dneinwsttflhippq etkgc gh  kg   
                                  kd f llgn lq   f twnqfsage  ng anea      af   
                                  ga e dg    g   c givm l     a   k             
                                     a       c     dese c                       

       250       260       270       280       290         
rlctdftysslldaplhhsgnvtqnqqqdfephqksftrastfhqletml cn      
pkyrqqpsaqhglylhssltgtqeelhkaarl   pdl  ca dffce           
l rllglq pe hvgtpag  rfdvracmvg                            
      ae k  gma l c  paaskt gg                             
            ai  k     v i f c                              
© 1998-2019