Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------makq---------psdvs--------------------------secdreGrqlqpae-----
mepsqcveeleddvfqpedgetwvpcqicgd----gsllsadlfaqslldcplsrlqlfplthscgp-lrptsqgdkatq
 kfgmgsamfqipever--q-         -vtqp prtpmkqlpgarrgpgprvprplstasaaerrsgas--lggpsg
 pgkkarkqacpcplpase-t         tgvam     ggfgm  aqa  cq  aaa a-r-rqql-s-etv-tlerd
        ns vsqas arsp         ewsrh                          rpvg-likas-msrsr gc
         m  r  r pimm         arepg                          q-r-ta f-irapqa  e 
               h g la          a cc                          mwpyk- cv p m      
                 d                a                          cllpc  an g l      
                                                              igka   e a        
                                                              a e               
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--rppql-------------------rpga--ptslqtepq---------------------p-----------------
tlshaspgrlvpsavscglcepglaasq-vmldagvteaqpgnpegnhggegdscpsgspqg-lgppaspgpfatrsplf
sgk-hrqaarclplrphrptrrhr  a-allwlclhsq-ylrlfyhhaeyrlplpahrpavlsiaeqpperqwqhqaevq
gp-s---                   -ap-vp----pas-atsssapgsagaveirgfhssylastedgcfmgerppsfr
r grfps                   tklgf sswt--ql-camtrfpavtca ggdawvgdhrlrrqemeesreeqggs
h efvvg                   kh ta gmtpgvpdsprlrpgr sa m ak cvtavapeqasdgsvdgsyitaa
    tha                   h  r  akeges chdq ad d l     s  l rr ecwvrvddsrvpn rqp
                                 gad p a  p               r l    vsg a r lnh d m
                                     g                    a      ig    g hca a e
                                     d                                          
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------drspapmsc------------------------------------p-p---qafnhyls
ifmrrssllsrsssgyfsfdt---------eeeqwareigaqlrrmaddlnaqyerrrqdrkstqt-s-pcl--------
larksacpalqfarrhvqqhqqnqnrvwwq                     ctrpvdvreeqqrhrsplwreillflhnl
grsqlqpindpahqlagageplqrmpdefa                           aetvgavrl q tt dsywtikk
qlemhlgspvwyepswqrlgrtwpvstvrv                             qsrllpa f rl vtwtsfmg
kwqlvgetvalvgfirlttvlseltwsstg                             m  galk a gk gpvqqwre
 spetemmsgtlddepaealgr dalrtns                                  a    da pkahprqc
   agdlh egg  dls  kdp arkgrgr                                          cg gflh 
    d d    c   id    i tq qpam                                          a   d e 
    a          e     g nl ll l                                                  
                     a hg  k                                                    
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ama-mr----a-mr------------------------------------------------------------------
-l-s--qaep-g--peiwiaqelrrigdswlppnlgrgssdefnayyarrlelppdssaeevvrmvilrllryivrlvwr
g-vlepnpngpdtptqmrqssswtdvfqlswdrlfiftglalsghhhsqdmpklnyretsdhpvialh evqwplkwlak
lvngierrrsrrpavnlgsvprplllrrayrcfgysqrthvpyqsgggttvfqnlhqdigssl                 
tpprwiglkavergrswprhllyegallkrgrqtspphlamsaslflclmtapfrakaf                     
rigvpdehvvwpvekrnlnctarv  a  lfl apakd  lalpde    qi   cv                       
namnfwteqtslswemeea   ag     g      g      k            d                       
i htvslspnh ltagc      f                                                        
  dqtqk fc  d  a                                                                
   inah a   a                                                                   
   cl a                                                                         
    a                                                                           

  
..
  
--
mh
ss
  
  
  
  
  
  
  
  
  
© 1998-2019