Dataset for protein Bmf of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************. *      * *  .. *     *  :*..: *                              
GVMLPCGVTEEPQRLFYgnAgyrlplPaSfpavlPigeqpPegqWqhqaEvqiarklqciadqfhrlhvqqhqqnqnrvw
                 ap e----- k cvvad plpaq cfe rreq ------------------------------

       170       180    
....:....|....:....|....
                     *  
wqillflhnlalngeenrngaGpr
--------------------r rp
© 1998-2019