Dataset for protein Puma of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       *                                                                        
mkfgmgsAqacpcqvpraasttwvpcqic--r-r-----p------ar-gp---rp-pl----p-a----l---------
------m ---------------------gp-a-qegss-epvegl--d--gpr--f--grlv-s-vscg-rplrarpgc
 ap sa                          e hgprt ggqlpg  r       a  parp g lgsv          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------c-p-----p------p------------ap---p----al-------------------gg---pggp-s
rprrphpaar-e-glaaa-aaptll-aayplawgsplc--tap-avta--alaggaapgvaraqrpggs--srw----r-
           l lrphr trrhrr ggf       qp  rpa grss                       rsh    g 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     .   :       ... :     :*  ** ..  *.           : **         
-prg--------------dgpqpslslaeqhlespvpsapg--aLagGPtqaapGvrg--eeeqwareiGAqlrrmaddl
r---ggtvgpgdrgpprp-etrgqrtvrplttrgaaqaphltpt t-  vssrh t--lt-------q-  ctgpv----
               aaa  g  aaaapaae     a h      eq  q phd apa  qgp sp dl     actrpv

       250       260       270       280     
....:....|....:....|....:....|....:....|....:
    .           ...      :                   
naqyerrrqeeqqrhrpspwrvlynlimgllplprghrapemepn
----svgdslprpltpadtldsagtm-------------------
dvrddg  pggp dpl  agaf cdflctm               
© 1998-2019