Dataset for protein Bmf of organism Hippocampus comes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEDEEDDVFEPDPHCWRTTFKEIKCEERATQTPGPVPASNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGEQEERL

        90       100       110       120       130     
....:....|....:....|....:....|....:....|....:....|....:
*******************************************************
QESDDGMEQQLQQQQQQQPVARSIEACVGQKLQLIGDQFHREHLQLVSRNQHKHK
© 1998-2019