Dataset for protein Noxa of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
*******************                                      * :*: * .   :. :  :**. 
                   gpagtardqagfgiemqlrftrgkkllsssplalprgh ee ec gqlrcfgdkeif  ke

        90       100       110       120       130       140       150
*                         .*:.* *                   *.*:              
 paetsesdiqtlllrnltasktcmrg iq l lrrctfhqfeerlhcnwee e afmgalgngrwntsk
© 1998-2019