Dataset for protein classical BH3-containing proteins of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------makqpsdvssecdregrqlqP-------------------aerppqlrpgapts----lqtepqgpp
mpgkkarknmmfqipefepseqedsssaedgfglspagdgpsgfgiemqlrftsgkhhrqa--llwdadlfashqqe-n-
         aqps----mrpspcveelydqvaedptterdqa           --------sp--l-    -gslldq-t
          cseprrrserpnaqtatsrgr   agma               rdgelvtqaasv-p    v-d-e-crl
            cvlplkagllv plpqlap                      esskalst  rakg    rt-s-hvqv
               hkg ekem   c a l                         a   s     a          dld
               ga   i                                                           
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
sgnhgge--------------p--spgp--trsplfifmrrss-l------------drspapmscdkstqtpsppcqaf
e------gdscphgspqgpla-pa----fa-------------l-srsssgyfsfdtp-l--a---------r----ef-
-ssrhfglthvegpgrrptyqagtedeelvsenasqgvglsrgateepqrlfygpag-s-wl-qryprvlel-rvsd--v
prlqldpagamcirdllssspedkatqtgspaetpplrltpevvp        an eynavvvaltgqtepigpmlvtsl
mwrdvcysrra as ahtlrwgwwgsdqrmgsr eafaqqlclsm            qv lgsnipask kmenlkrspq
ame ras ec       a  s tscatmqrwlq dwpmeaenadi            mt g rfdgql  ha gq qkkm
    f r             l sl  adeih l aral   d  g            hk c  e f g  d  e  p gc
                      ci   ad a    l k   a                     d e a  c  d  l  a
                                                                            a   
                                                                                

       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
                                                                          
nhylsamasmrq-epa-------------r----f------r--------------------------------
------------a---dmrpeiwiaqelr-igde-nayyar-lsllpsqsaelhprmvilrllryivrlvwrmh
dsfrtlkvgiprpkcsptptqrrqssswtsvfqswwqanlllghknsylagrdtsssgrrv             
wqwtrevkrlaklwtvgsqrimlthtgygqyenvvsdrlgggvpsanqwptmwrqlpspc              
glrqk renwsedvstsvlfhlgsvlqhvlsyhrlpwqteqfrfntvlsglgnlnklk                
fgh a qsivmprsvplnawggfltkn qerqgphmglr n pwvslpnee aaligf                
 f    lqvgllfrrifh gfe hfc  e npah l di k nltpgkh     aga                 
 e     nlfiheqggad  aa      d k  a g      merefd                          
       g eed iad              c           aa daa                          
         ad  f                                                            
© 1998-2019