Dataset for protein classical BH3-containing proteins of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 f-m gqkveilaqp--vra-edge vtq  s                       pthc--s-lrltsqedkatsgkhpr
 sme pkcadgn--dlp-f-l--                                l---cdqg fgilrssrfqqtlsrl
 cpv llsr  -me- ly-                                    -gverc a   gemqla  r akla
  ec  hrg     t                                        aataa              l  a  

        90       100       110       120       130       140       150       160
ksspgellvcgvtrervplrrvdylecm gsdarnarsrtwss-pavsvlavaaagllevtmv-r-g-eserqrvlierm
  l damhrttseqvqdagfy cs         la  lplslptsrrwsettywpeveaqslqvqv-swqtqgttwmnpl
       gqrdmw rla  ed  e         g    gcpg  qfiprscpvpmwtcd qimteprdninfsqrkedni
         g e  d                         i   meehlr irllqp c dglr gq k ld kpid ls
                                            dd  kq elgkpa     hg    f g  gkha g 
                                                a  dged       ef    d     if  e 
                                                               a          ed    

       170       180       190       200       210       220      
lvssvwgwq frsnvayrwstgvaremlqfseygqaawwllamnaggawnaiqlrnrahqlgf   
vrlamslvl  tg qmlfrrssrqhvlgttrpvvwrygvhmqsyhr rpvtgpneam gpi     
kqt fritf     ilhahqphqlgge sqqlqsepwaqigllsgk p tselh    al      
glk cgfg      dc  ehhfndf   npcgpq kt p akfr     lg k             
ak  aa a           c  h     me dln cp a  g          e             
 g                          ha  fe  l                             
© 1998-2019