Dataset for protein classical BH3-containing proteins of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
makqPsdvssecdregrqlqpaerppqlrpga----------------------ptslqtepqgnpegshggegdscphg
--qi-efep--qedsssaerglgpstagdgpsglsadlfaqslsgkhhrqapgllwdashqqeq-t-sn----------r
 f-er----ekl--p--vfaledgesvtq---lfgiemqlrftldcplsrlqlf-lthccglg-p-s--lhkgtttlsp-
 sm- pqcvri-mqdlpyr kraqagta-ds            r  k lsvspvt-----sepvrvatqedcaagaveia
 cpv glsrd nam- llh  n   ap-acq                  esl  rdprrsldaledtdrrvrysqqynws
  em  kka    et kka       mc a                        a gegd a mqcfa  ramr ksiqe
   c                                                      e     l     k le eehl 
                                                                      e f   daf 
                                                                              e 
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
spqgplappa--------------------r-------------------------drspapmscdkstqtpsppcqafn
----------sqsqtslpvlvgsspgpfat-splfifmrrssllsrsssgyfsfdt-sa---l-l-t----gr-------
qrsssypastlgmla        eldegmgaprspfrgqhpenvkygnl lwrsgva--svv-n-w-aqry--elrrvwd
wthqnvmlgcfdlg         ldtvslseeltvtlal a   fleaa  rlplpttrmtspgrgayypwtevyadmsr
tmllgaetksacid         gvsrnpr  kpdsese                  vqksrtayastwgqscsvhgqpq
rkwrrsisar              mlqekq  aacq  a                  lp qfrrirpileklqriecpll
leeedrgr l              a a  l    am                     ef h gp pfhkdfe ka  nae
   acidn k                                                e    f cefh    d     a
       d e                                                          e    a      
                                                                                
                                                                                

       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
                                                                          
hylsamas---------rp-------------------------------------------------------
-----f--mrqaepgdm--eiwiaqelrrigdefnayyarrlhrnlgrgsedpskmvilrllryivrlvwrmhr
efvds-gkrnediralplspsagtatqmpqssswtrvfqswwfllnyqalwalprsshnla ngeenrngagp 
sapwpyvrwllqvkrss wkvs swvsqlyvlvhsqltvqlvdkpvswvaswhlqfl                 
pcqqlltwlkdnsavrw ritq rtsaiefrhqglldllaqnqqeqqsswhqtal                   
l mpg mvii e vdfv afnp qrk dcaaclah  he  mppdpnnpt ni                     
  egc etfe   m ar   ll flg  a   h        hl afdg r l                      
  aa   ned   g      gf  h       g         e   a                           
       i            ae                    a                               
       g                                                                  
       a                                                                  
© 1998-2019