Dataset for protein Bad of organism Gorilla gorilla gorilla

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************************************************************   :       ..    .
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGgatsveirsrhssypagt
                                                              ergayspswesensenps
                                                               g  speer   dad ak

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             * . *     .   .                   : ..*    :   :**.          .:    
-------------EddeGmgeppspfrgr------------------trsaPpnlwaaqryGRel------fvdsf-kkg
lqmlaslpvlvgs lsq ksrelpvtfaqhpenvklealglwrsgvasppv tgrrttlgw  s-rrmsde-pqpygarr
agld          aga  la aadse a a                 a t ra gshke   ky        aa a a 

       170       180       190       200
....:....|....:....|....:....|....:....|
   .   *  : :   .                       
lprppsaGtatqmrqsssw---------------------
svlskts rlsaipfrcv-trvfqswwdrnlgrgssapsq
ar   le qh   aa  gg                     
© 1998-2019