Dataset for protein classical BH3-containing proteins of organism Gallus gallus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
mdrpsyleedyssldgldddvfhsddfglagqpgemtatgiftqnqsyscllgrfqlfplthccgpgvrhpeqqdkatqt
--------------------------------------------------------------------------------
                                                             mmp rti k          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 .**..    *  .:   *   * *   : *   * : : : .*.  .
lspssssqdvmlpcgvteeprrlfygnagyrlhvPPvgfaldPnlqeepqEgqrEaRtevqiArklQciadqfhrLhiqr
---------------------------------a  aa---- aerdava cal l rigdk dlq kvlnlitk fcpk
                                                                                

       170       180       190       200
....:....|....:....|....:....|....:....|
                                        
hqqnrnqvwwqlflfl------hnlalnveanrnrtgqr-
vgcfhrgr-glsy-rvvlqktgsr-r-srllpkaaa-y-q
t------- ---- --      -- - --------- -  
© 1998-2019