Dataset for protein classical BH3-containing proteins of organism Fundulus heteroclitus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             ..           .   :   ..  ::.*  .   ...    .  .  *. 
-------------------------medeeddvfepdpncwrtpfreikcedrgtqtPgpalapnngmlpcgvaeepRq-
mspssssvtlcssyrprnqrnsstsvtppsgtngpnsssprtprlskht-sgsdsep eevteeggdqpepdsvspl sr
      mhig fpnplp lidg pec fi  lg d acladd maa fri   c   a e a   ggad kd     i
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :  . . : :     .:       : .                                       :
-------------lfygnagfrlh---fpahfelvgdfdarrqe-------------------------------eqnrm
spntldvfqrrsifrsssgyisfnseslastpssphpltgdketqtgtptgqvmnhalqrmaaehggqparilglhglsf
hals       pe  k h r   dc  h   ilreee q  aa eaas                             hp 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       .  :      *.:*. :.*::     .                     .        .               
eplplhqpaalsleaciGqkLqligDqfhrehlqq-----------------yhqnqrnqgplww------rmtaallsl
snrsnsaardm-qpkry rq rrms eynsllmrmrgrfrsslaagevgkpmqytsvytnrltphsrsepv---------
ra qgn   waaekf     a     gnh dkgels              kvsdmvsln mh lqqclsallcvg l 
                                   a                 qr agp c ic ian     a e  i 

       250       260       
....:....|....:....|....:..
     :.                    
lldrglvagrggagrr-----------
-wwpyfm--q------shsqvhaprte
ceintilyl-ettnsnd hen      
  fgr fsh  se eh           
© 1998-2019