Dataset for protein Bmf of organism Fundulus heteroclitus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEDEEDDVFEPDPNCWRTPFREIKCEDRGTQTPGPALAPNNGMLPCGVAEEPRQLFYGNAGFRLHFPAHFELVGDFDARR
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************************************                 *: *  .* *  *      *:
QEEQNRMEPLPLHQPAALSLEACIGQKLQLIGDQFHREHLQQ-----------------YhqNqrnQgPlwW------Rm
                                          rgsfrsslaagevgkpm yt vys c tc lancls l

       170       180   
....:....|....:....|...
:* ** *     ::         
tAaLLsLlldrgfvagrggagrr
a e  i cefptll---------
© 1998-2019