Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
makqpsdvsse-dreggqlqpaerppqlrpgaptslqteqq----------------------------------p--p-
-----------c-lv--------v-----------a-----gnrrrrrpgrrrprplspqpegegdrcpqgspqg-la-p
vymerpqcveppy--pdvfrsgd-ergtqrvsllp-vlfacsqgag gl pk  a  a  lpcplshlqlfplahcagsg
 mrtaqnprac tqgd psmfeteqfeasklpvskwncvg vp                 sd diglvlrplrtrwcrrv
  ls gegl a rp e lggespccar  h vs avsgre l                     a    ep  k d    a
  ga eaa    eh   gafdpg   p  c gr  g                                      a     
                 a    c                                                         
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--p---a-r-----------------------------------------p--apmscdkstqtpspPc-----------
as-gpf-t-spffifvrrssllsqgprprawgssqfrsssgyfsfdtdrs-tg----psp-----ms-vgvteepqrlfy
lr tsqedkatlppywtaargrrp gpdl  aqpm qwprfpprrssgstlddrtlp---psrrvel gkrqrttpg lg
tv vaylrapgarqhrperlhpp             pi gaer eqrapr a qqpmlasaedhl-g - hp        
rl r a c l    a    a gg              a e a   pe l    pgaggiatg gsr- s           
   a                                                  a   g ra k gq             
                                                            g    ac             
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------qafnhylsgmasmrqpg-----------------------------avpadmrpeiwiaqelrrigdefnayy
gpahyrlppass--aagp-a---qsrhssypdgtrpqrgvreeetspfrgrsrvrg-e--aave-grq-------l----
enggqqg----gav----t-vet-d gpaaaa geedeateaa p     aaa-l-l-lq----y-a-tqamaqd-hglt
aa     kspp-vsppsvlqaaer                             tareteewprqwh-sqpclt qprrrq
       hlhrprphdlggptsap                             s-hwrswr qrt mr k fs k qqsh
         ga nh  a rgig                               rpepqhsg lls hk      g  fpg
            gg    c e                                pg fpc     c  g           f
            f       c                                lf  na                     
                                                     e                          

       250       260       270       280       
....:....|....:....|....:....|....:....|....:..
                                               
prr------r-------------------------------------
---rqqnqy-arpagwlvlynlllrylvrpvargarlmgrnnsfptq
mgqvllenrqpaesqprmiilripglipllrwwlqpelepgglacsm
kwmlfevsqshwwvptqttrwqwmsatrqvqslwdwnasardf    
eqlqrrsrtfyvstilapqmtps pweenrngaapa           
dlapeirpl vsgq d gghr p n aafia                
   nagaka rpdp a f    a c                      
   h a c   ka                                  
           i                                   
© 1998-2019