Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :*.:  .* : :   :** :  *  .**:  *   :  .*                                     
makqPsdvssEcdreggqlQPaerpPqlrPGaptS---lqteQqgnpegegdrcpqgspqgplappaspgpfatr-----
--me pqcve ledd--vf  edve gtq  sll anlfaqs l-------------------------------tlspa
                                            dc lshlqlf lthcc  glr t qedk  q     
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
spffifvrrssllsrsssgyfsfdtdrspapmscdkstqtpsppcqafnhylsamasmrqpqavpadmrpeiwiaqelrr
-----------------------------------a--pl--q--------r-e---a---g------------------
  sqgvmlpcgvteepqrlfygpagy lkp s vv-gs--gt- peghwqh-r-vvw-isq-vledqfhrlhmqqhqqn 
                     an      l a fp dl   e     gfec a qqrg kl lia               
                                                       ei  ee cf                

       170       180       190       200    
....:....|....:....|....:....|....:....|....
                                            
igdefnayyprr--------------------------------
------------vflnnyqaaeaqpqmiilrllryivrlvwrlq
rrvwwqillflhllrvpasynrngagpr                
            neql  eei                       
             aa                             
© 1998-2018