Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--kqpsdvssecdreggqlqpaerppqlrpgapts---lqteqq--p-----r-p-----gp-a-p--------------
ma------------------------g-q--srlpanl--q---gn-egegd-c-qgspq--l-p-aspgpfatrspffi
vymeapqcverprqvpsvfmsedver-t-rvpl--kvgfa-spldcrlshlqlprpthccs glrstvqeayradparsv
 mlt gnpracledd  ssgfvteqaeamkdg-rrgsarplvrrvrsrvgrr felll ap adlgrllr llcaw grp
  gs eaam aaylg  ppfesgcc r ah -v k    g l grp gpspk  a  a  a   ial  a  k       
        l   th   gge pc      c ks      e    ag al cg                            
                 a   g                                                          
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------drspapmscdkstqtpsppc-------qafnh-----------ylsgmasmr--------
fvrrssllsrsssgyfsfdt------l-pa-psp-----eqvteepv-----nrgyrpsptas---a-----rttpgllg
ttpvpaatraplrprwpgrrrkrtqt-r--w-q-svmla-ghpsssqrsapggaalplplpgqrpa-pptqa        
rrapaqvrallgpqhrregphsaqggpprgsg-sglqacsfelrrqspltyad  aggiag daarpggrvv        
          g g    aaagpg rwvhv rap qfpi raa    ed slt           p k lvlrq        
                     mc c rdl g   m c          a               f g  skhp        
                           c  c   a                                  ggi        
                                                                      ae        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------qpgavpadmrpeiwiaqelrrigdefnayy
eaghqqgqpgssnspggggavgtrsrhssypdgtrpqrgvreeetspfrgaaqvlg----aave-gaq---ma--l----
       h a pghh  a   epgd gpaaaa geedeateaa p     --spr-lqlq----y---wqa--qd-hglt
                                                  rsrtareeeewprrthrrtpclt qprrrq
                                                  eepsphwtswg qqsemk k ss k qqsh
                                                   dargetrpsf llr hg g fq g  fpg
                                                     lf pphg  c c              f
                                                     e   na                     
                                                                                

       250       260       270       280       
....:....|....:....|....:....|....:....|....:..
                                               
prr------r-------------------------------------
---rqqnqy-arpagwlvlynlllrylvrpvargarlmgrnnsfptq
mgqvllenrqpaesqprmiilripglipllrwwlqpelepgglacsm
kwmlfevsqshwwvptqttrwqwmsatrqvqslwdwnasardf    
eqlqrrsrtfyvstilapqmtps pweenrngaapa           
dlapeirpl vsgq d gghr p n aafia                
   nagaka rpdp a f    a c                      
   h a c   ka                                  
           i                                   
© 1998-2019