Dataset for protein classical BH3-containing proteins of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------makqpsdvssecdreggqlqpaerppqlrpg--------aptslqteqq--
mgtpenplsapthvpgpgmsgtmqreprk--r--p-------l-ddvfg-edveagts--diskadwasll-------gn
                      ecpcalhrp-er-qgveqvy-v--r--r------aqrv        g--avnlfahsq
                             ggmtkqvcr p ppser-arlsssrfr--cl        -vvtasvalatr
                                g ae     ecra l  errpc p taa        vss  pd     
                                a  a     a g  g  dkp a l            r k  gc     
                                                  gc                            
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------cp---pq--plap-a-pgpf-t---------------------------r-p---------mscdkstqtpsp
pegegdr--qgs--gf----p-s----a-rspffifvrrssllsrsssgyfsfdtd-s-aphqrttslsp-e----s---
ldlpqywrelshlglg wthccgqslrpipptepseqtdalptp wpgpsptrsrp g rkdgpqppg--g-qhle-lv 
ag   gl  pal aq  rvrawl qmylcaefa pa ea  ggd gl    pg      g        lqekrarkqgq 
         a g  a  adcvlc aasq                                         la ath  a  
                      a                                                  g      
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pcqaf---lsamatmrqpqav---------------------------padmrpeiwiarelrrig---defnayyprr-
ssp--nhy---g-s----gvfygpagyrlppptsvvapsplrtqprsgg---q-a-e-gqq----apap--l-------v
a--sqgvmapg-v-qepq-l- an  teeklgsefpegl fpgrspea-eee-w-v-y---rscm-   gd-qtlwkwlr
-asgahgg acvpreaahr-r        de a ee d   ge     rwqlwrtrrwrasqq rs    q prsqeqql
 panh    g  e rsressy                           hpphea qqr mk   f     k hgrhmlmp
              aie   l                           efnc   m c  a         a  f f g n
                                                   a   l                       h
                                                                               c

       250       260       270        
....:....|....:....|....:....|....:...
                                      
--------------------------------------
qqnqyraapaqwqvlynlllrylvrprwrgqpemepnq
flenqqhrespprmiilrimglipllvallargsa s 
aevsasywwqwllsrswtrfnqswwrnna rg      
rrsrvgvsttmr gpr  a iaeend g  p       
lpkprftlg i  f h                      
eiaklaria                             
 a                                    
© 1998-2019