Dataset for protein Bmf of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPPQCVEELEDDVFQPEDVEPGTQPGSLLSANLFAQSQLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************. *      *:*. *. **  **    :: * * : .*.                        
GVMLPCGVTEEPQRLFYgpA----ppPsSvvAgsPLptQP---hwqhRrEvqwgRsq-----------------------
                 an gyrlkl a fp dl  ge  peggfec a qeia klqciadqfhrlhmqqhqqnrrrvw

       170       180    
....:....|....:....|....
                        
------------------------
wqillflhnlalnaeenrngagpr
© 1998-2018