Dataset for protein Puma of organism Felis catus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        .* *    :*                                              
-----g----c------------caRaRqvgstP------ar-gp---rp-pls---p-a----l---------------
yylsg-lgrs-vrqvpgasffpgmp e hgpvs gpvlpl--r--gpr--f---rqv-s-vsrv-rplrarparrprrpr
vlgga aaea p                ce    egqegg  d       a   plp g lgcg                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            .                                             *     
---------p--pa-----p--p-l-wvsyqcap-a-p----al-----------g---pggp--rp----p--Pqpsls
paarrlplr-hr--rrhrr-gg-p-lpgcvlp--t-p-rvts--tlagraapgig-prw----rs--rpps-gs -----
       ce gl      a aa a a aapa   r a arsa            a aqr    gg  hggr dg      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  **   ..** **     *   *.. .* .          *  * .   .:*  .* .     
paeqhlespvpsapgalaGGptqaaPGvRGeeeqwAreiGaqlrRmaddlnalyerrRqeEqqrhrpsPwrvLynlimgl
------------------  ggavg  d  p---- aad grpq av---------- aa trgaaat plt eg-----
                                                                                

       250       260       270       280       290        
....:....|....:....|....:....|....:....|....:....|....:...
 *:   .*:* :  .                                           
lPlprarGaPemepn-------------------------------------------
- vqshh t altqgprgpgdgaqlgactrpvdvgdlggrtlpppdalasagdffctm
                                                          
© 1998-2019