Dataset for protein classical BH3-containing proteins of organism Esox lucius

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                           .            :*    :   . . .    .    
----f----t---vgdipenine-------g-t------frntstntsqr-----mlPgv-rlrlysrsqvfstvgtsss
mfma-kmdh-qdc----e---k-kysldhl-t-hypkfqdcpsqcegnnqsrlgitm tnslvgfqpepplcrqtsrqdn
 ensstpsnrssgtttv-gtv-ipedypwhtasssseys-ygq gp tslllgsln  c-g idqn   lfygns grrh
  di riqd eness lidrkf gd hccg   rei lewieg  k ga ag nd    e     d      a a fel 
             me e  dg                    a                                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .::           :         .      . .                                       * :*
--tefqcdstptspslrnakpfrtrsqsappalwaar-------------------------------------lyGqqL
gyfsldvamigseelggdnastqgphpqsqvithvmkrlskpqdtwrgyeawptphhpyrprpppipgdmrpeiki ce 
fpgq egvgq lpqvrtqgvrggve   ql qqp                                a       r  rk 
  a    l d gncqape l   m                                                  c     
                                                                                

       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
. :.*:*                  .                 :                        
rrmsDeFdtwldkge-kr--ipgrakqv--yrlww-------sflwspkeaegrd-------------
qlig q nnlfih--p--giysrasrnqvtspglfrpyqgpltlklm--------tpnwrrteprsse
       h----- qmhlvlvl nrnmptlrhsiyqmhselhfi feqllvgtllriiliir      
               e  qksh cq gm aqan pkla a ac    heatargkqag          
                    ra     l  h           a    g  i  eg             
© 1998-2019