Dataset for protein Bim of organism Esox lucius

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                          .*************************************
----------------------------------------ypsSCEGNQQSRGGIMMPTNSLLGFQSRSPLFRTTSTSSS
mfdssrpqnrsngtttligrgkigeshpcggatsssklsdreq                                     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************************************                             .*************
GYFSFDCDSIPSSPLLRNNKSTQTPSPSSQVITHAMR-----------------------------pGDMRPEILIGQEL
                                     rlskpqdtwrgyeawptphhpyrprpppia             

       170       180       190       200       210      
....:....|....:....|....:....|....:....|....:....|....:.
**************  *. :  * :  : : :* *  :                  
QRIGDEFNNLFIHGvsGcsnmqVlqhnlyqpyQgPhfllws---------------
              rl arkgp ahalipkmh e aciklmglligrllqiiwrrr
© 1998-2019