Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------p--g-----pr------l---------------------------ptavsdklgqp
mgtpenpsmeppqcveeleddvfq-ed-epgtq--sllsad-fapsqldcplshlrlfplthccgrglr-ssqergatet
        prktraratrksttwhsvtrrgvsreggssrysvvcgamfqi efeqsepedsspadp mgg-p-----c--
         a rmrqgrq rsspf nsaplrrka pgrlsrpg   e                    gm r-twswv-pv
            h h aa gqame ae lapdg   fp gg a                         c krlhgsssde
                      ed  a a aae   aa  a                             c kgcrr a 
                                                                        aa  p   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .                                                                          
lspasp-spgl-lpagl--------------g-r-pea-s-pa--plg------------------es-p----------
mvqvgtaa---m-----cateepqrlfygng-y-s---l-v--rt---tgpqpsllpepqplrsrv--s-galeggptqa
vrtrasv-rdvlpdcfv  sqgqpavtshlahrglvlparrrgmlettdedegmegeaeghfegpsrqpg          
sphqra gqa fgeryh  qgdn  ssaahp p wartrefhsgarrr                  p a           
glclc      c a c   paa       a  e k ggp sgpsy ep                    e           
aa                 h            a a   g                                         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   .     :...                                                   
-------egqwrh----qiarrlrrigdelhrrwmq-hqaerprv----l-f-yn-------------------------
apgvrgedsdnqdraevsvgmqpqfmasqfnvlh--r--------wwyt-l-t--qtglrgvfrsfmdgltnlrenirfw
       ----a-slaqey akiacvs kme---glqriqnlnghavqswavlhwpw             pq  pgapts
       rnrl-se  art ke sdl  dcqqeyewpqrersr arpsparp                            
       pllikrd   lm i  ka     df t rl p  qq  papg                               
       keg  k     c            a q                                              
            a                    g                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                :                               
----------l----------------------------------q-llsslapftpssgtl-p-p----w---------
sfltrrdrvs-rfnglespsgagpplqpwssgpvghslagchsph-syiqaflclplgrscpf-g-lglv-layelrrig
lqieqq  spvalhdddnrncmcsscemrqrcvlwkl     qtwtlqvmnwwawlhrqav-adsvrspr slq      
          asmsc prtqtpstrtgknve   re      pssnrp lgmpsrsrcprnsqmnqnqe  i        
           p qa k  ks   af  g             lgldhk aehiemrqac gngefmkp            
                                          ecfaaf  c  dknf   fce el              
                                          aaa  a            a                   

       330       340       350       360  
....:....|....:....|....:....|....:....|..
                                          
------------------------------------------
defnasyprrvvlnhhqaaeahpqmiilrllryiirlvrrlq
                                          
                                          
                                          
                                          
                                          
© 1998-2019