Dataset for protein classical BH3-containing proteins of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------meppqcveelkddvfqpedgepgtqprsllsadl-a-s----p---------------gl-ptsqedkatqt
mgtpenps----------e-----------------------f-p-qldc-lshlrlfplthccgp--r-----------
        prktrrqgtr-sttwhsntrrlvskeggssrysva g mfqi efeqsepedsspadr  g spvwswvsep
         a rhahaaa rqaed  s pgpre   gr  gp                            katg spgde

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:    . : .::  .   :                . .  .      .                  .* . .        
msqvsp-srglmlpagvte----------g-rspeplsvpgmtplges------------------sPesqwrhr---sv
lrpagtvaqdvfgdcflhqepqrlfygna-yglvlaaefhagleettqdegmegeepgpfrgrsrsp dgdnqd-aevqi
v hqr   p  l e  hq gqpassshhg a a  tr ssy    e                  a pnl aa    ry
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.  *  :.*::                                                            : ::     
arrLqfigDefhvrwmqqhqqnrprvwwytllftyn-----------------------------------lrfnglesp
gmk acma qmerlh-lp-iaelng-avqs-a-lh-qtglrgvfrsfmdgltnlrenirfwsfltrrdrvsvalhdddnr
  e rr s   q--- -- ------ ---- - --                                     s qa pr 
                                                                                

       250       260       270       280       290     
....:....|....:....|....:....|....:....|....:....|....:
.   .                        :.         .              
sgagsplqpwssgpvghs-----sphqsllssfacftpssgclfpgplg--wl--
ncmcpstemrqrc-----lagchptwtlpiqewwprshgrstsqesv--lr--ay
ks  trfgknve-vlwkl     essdrf  clpelplcp gngdnqkspv sl 
     ac  g     re      agl  a   hld n ac fca fl q      
© 1998-2019