Dataset for protein Bmf of organism Equus caballus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
                                                                                

       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
***********************    .  * :.:    :* **    :.*. *   : : .  *  
WQTLLFLHNLALNGDENRNGAGPsfqpnvrGvvwksetsqLpLSelpplsPcpGtnqenvls--Ws-
                       rcgkgqe plrelagld f  chlefp ac fcgdflkqpv ll
© 1998-2019