Dataset for protein classical BH3-containing proteins of organism Dipodomys ordii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                       .   .                                  *   * .      .    
ivpgemeppqcvaeled--fqacsgspsqlqplllsatlfarsqldcplsrlqlfplthccp qpc gspldkahqqlgp
           ------fe---qeeas vtpdafiktl y--                   m s   apgelpi spm-n
            fqi e  p  m d   ad          q                              fgd    qg

        90       100       110       120       130       140       150       160
ppg pege dacaqespqghlap  gmeedagl                         devws fr rsrenqvnlfcga
le                                                          e d  d leg a  a     

       170       180       190       200       210       220       230       240
                        :.        *  :.*::                                    :.
fnyy-slp-smrqs-qp-egl-v-lqaarr--qk qcma qmhalhrsprr-rrvglnnyqared-hrdralrlvllflh
aghr pam gfpaa ee adh p i     yg--  s    qslkglplaqspftatq-----y------------m 
                                           grf      kla m ihsl lt s  gv  v  rl  

       250       260       270       280      
qssswtriirs wdpilglgsa g                      
g  hl ahfqa                                   
© 1998-2019