Dataset for protein Bmf of organism Dipodomys ordii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     ***************************************************************************
-----MEPPQCVEELEDDVFQAEDGEPGTQPGSLLSATLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
ivpge                                                                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
ASPSQGVMLPCGVTEEPQRLFYGSAGYRLPLPAGFPAAQQPPEGHRVEVQIARKLQCIADQFHRLHTQRHQQHRDRAWGQ
                                                                                

       170       180 
....:....|....:....|.
*********************
VLLFLHNLALNRENRDRAGPR
                     
© 1998-2018