Dataset for protein Bim of organism Danio rerio

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MSDTSREQTLANGPASQGSGESTGGGVVLPAGHFDFPQPGEGDPLRGGISMSNNQSRSPMNRTFSRSSSGYFSVDSDSVP
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************************************************************.**********
GSPLMPNISEAQDGQNDEVWLSEHSHQHLQMAAPVAALPPEMVVARELRRIGDEFNRLYCEAGAGVNQLrAPNEHAIVLW
                                                                     h          

       170      
....:....|....:.
** *************
MNvIIGRLVHFFLRRR
  d             
© 1998-2018