Dataset for protein classical BH3-containing proteins of organism Cyprinodon variegatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     * .* :: .    .:*   *  *: :  :. ..  ..* : ..: *..                   *.   *  
---meEeeDdvfepd---pnSwhtPfrEi-kfedrgtqtpgpGvaphnvmLpcgvveeprplfyrnagfrlhFpahfElv
maqsv ts pimaatftisd dte se veetrnkeprirns kthrrir sse---------------sha tree ar
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*: :*   :*   :   . . *.**      *.:*. :.*:*     .  *.:       .  .. :.        ::  
GdfdVrrqaEhnrmeqlplqqPaALsleaciGqkLqiigDqF----hrehLqqy------hqvrrsqs------p-wwsy
 eee gtpt gypfrgrsnsa p  waakky rq rrms e vtlldkge rkvsstptprpnqqnkgltlppl-vyfrm
                                                     ipgqgfn lihhh a       l   l

       170       180       190  
....:....|....:....|....:....|..
  .         :     ..            
lssvvs------liggnswh------------
tfplqpllfdrgmecegkhrenhtqcteqrge
 aahle       c  ag              
© 1998-2019