Dataset for protein Bmf of organism Cyprinodon variegatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEEEEDDVFEPDPNSWHTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVEEPRPLFYRNAGFRLHFPAHFELVGDFDVRR
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************************************       *  :.:*.      *::: : :.::.*    
QAEHNRMEQLPLQQPAALSLEACIGQKLQIIGDQFHREHLQQy------HqvqrnQg------PvywsmtspvvsL----
                                          ipgqpfp lnhqh altlppl lwfrllaallp lfdr

         
....:....
    *. *.
--igGgkWr
glcc ag h
© 1998-2019