Dataset for protein Noxa of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******************  :                                                          
MPGKKARKNAQPSPARAQAgte----------------------------------------------------------
                   eldplgpaktqagrgrgrgkkllssplalprgheeqvqvarsrvcystqeiwrqtelpaet

        90       100       110       120      
....:....|....:....|....:....|....:....|....:.
             .   * :* : ..: :*. .: :: *.*.*.  
-------------vetkTqmRrlqkrlnlRr-tllqliArLhCs--
sesdsqtlllrnltaca cl gfgdkiff qckfhnfe k f ngt
© 1998-2018