Dataset for protein classical BH3-containing proteins of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
    mepsrgvkelkndvpgvedfqrsalvdtlsyadgfaqltme                vwgaphsr-dltssthcc 
       mpckea  da s  rpas etemlgaaqt r edkl                     vtdqql af lsd a 
                       i  did  c  k                                p    d me    

        90       100       110       120       130       140       150       160
p wyvgtelrsasnpsaprlpsiseglevslrdselqhrggprlprsrvvvspvatae a      rii rl-sr-rqlq
a rgselrcmhdehma lmhecedde dapa ap apfaeenkghppq qrpgrlq          lea giyqqskni 
   fr kk le  d    g a a a           a   a  eek p p  f             a   fgtdiegg  
   ad    ed                                 aa n a                    eaa e fd  

       170       180       190       200       210       220       230   
dmplsqgdwvecavvsiqgfqespnqfthtqnhvvwqkefvmqspvsag  g lg glk              
aladpgtrtkrtvtpnhkf g rlcp saselahhqni   flnfpq                          
 k  e mpsilrqsiad   f  k g d ndh acclg   cekelf                          
 e    lnqefgmre     a  f a   f a    ga    cadf                           
        idddikd              a      d                                    
        faa g                                                            
© 1998-2019