Dataset for protein Bmf of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************. *  .  : *. *         *  :*..  *   .. .* *     *. * *: :.    :
GVMLPCGVTEEPQRLFYgpAgyrsrvvAspPl-----pqqPegqWrrrqEvqipr-rLqCplhqgHrlHvQqhqrnrntv
                 an epklplp df avlpigeap cfe qhea rggaqvk g iadmf qe r eghqaglrl

       170       180     
....:....|....:....|....:
    *:*   :*:            
wwvkLlFlhylAl------------
clqi f ccnf fngeenrngagpr
© 1998-2018