Dataset for protein Bim of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQgnpegnhggegdscphgspqgplappaspgpfatrsplf
                                         ---------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          . ..*     . :*      : ** :*   :                       
ifmrrssllsrsssgyfsfdtDRSPAPMSCD-----KSTQTPSPPCQAFN-HYLSAMasrrqaepa-------i------
---------------------asrrqaepa mrpeiria elrrigde  ay arrlvvwl-----dmrpeir-aqelrr
                                                         grltessvvtslwrgvqftg dl
                                                         dniigevtria hfef       
                                                          kfeadild              
                                                          eed   g               
                                                           a                    

       170       180       190       200    
....:....|....:....|....:....|....:....|....
                                            
--------------------------------------------
igdefnayyarrvflnnyqaaedhpqmvilrllryivrlvwrmh
y hhhsqdteqlnsrpps                          
            mhkdfd                          
            le                              
                                            
                                            
© 1998-2019