Dataset for protein Bim of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQgnpegnhggegdscphgspqgplappaspgpfatrsplf
                                         ---------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          . ..*     . :*      : ** * :                          
ifmrrssllsrsssgyfsfdtDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMasrrqaepa---------------
---------------------asrrqaepa mrpeiria elrrigde  a yarrvv-l-----dmrpeiriaqelrri
                                                        --w-eevvvtslwigl ftg dly
                                                        lrkildstts  rfaf        
                                                        gnied isg               
                                                         afd  agd               
                                                          e                     

       170       180       190       200   
....:....|....:....|....:....|....:....|...
                                           
-------------------------------------------
gdefnayyarrvhlnnyqaaedhpqmvilrllryivrlvwrmh
 hhhsqdteqlnfrpvs                          
           mskepq                          
           le dfd                          
                                           
                                           
© 1998-2018