Dataset for protein classical BH3-containing proteins of organism Chlorocebus sabaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              *                                                 
-------------------------rsgarP-------ssv-shclceslll-----p--lpat-ltapgeeptsrs---
mfpsseverseqevsspepmppgpa-rnvq fplgrlvp--sa-lqasgg--qplsr-aq---ayvcslqdrlqvtedlg
qeqircmaplrddgfqsaevglklspparg       sdptv-qifrqvrrygqrlslqlmtv-rpsrqttq nqstpkp
 a gpaf ea   d    drcgcklmm p        i dlrrehemppeqwelpeeaptfrplqcrhfelp hpqqhhd
                   g e   hk n        g agkhdgdl a  ddaaaa l  elghakg  ak dfmaafa
                         ed k           a  caa     ac        c  g  d   d ad   a 
                          a                         a           a               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
m------------------------------------------------------------w---ay-r--qlrrmlnty
gqtwppgsrsrpvmlgcvetssrqslylantgyespvpssppalagrseqappglrgeeeq-rar--s-tapi-qasdsi
-prlggapp qg  rpprvdrpqprssyggqhlrmgmslrfsrvrqlptvpmhsv      slrqstrtrv--pkvfrlf
t             aeamp gepla rp eieedldleeeagpflpigrs aenq      gcdkrrqqpsepcglaqhl
p                g  edmh  f  ca d e   aa      g               a fqqgigddaadk pe 
                                                                 iheae        d 
                                                                   d          c 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
adqfcslrq----------------------w--rll-------------------------------------------
wswytrrt-vesqgtrtqmrqssswrrrprs-wa---yrlnlglnplenrgswaprqqvnlallllalllallsgglhll
vpsmktgpvqqqadmapei iaqeltninsplnqyyarnrima lge ppnhsvssmepl                    
nkllhgahrpkp             qhvmqmfadwv glhek      g  grg ee                       
lag ea a eah             e  gdf   is f              a                           
i a a    a a                f e    n                                            
                                                                                

  
..
  
--
lk
  
  
  
  
  
© 1998-2018