Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------------makqpsdv
msgvrpisrdtwmetllyeqllepltmevlgvtdpeedmfqipefepseqedssdmlalrlasaerglgpslagdr--rc
                                      ldpmed d l cmed         cigmkpdvls--melpq-
                                                                 iemc ghrr-- c-l
                                                                 dcf      rg aa 
                                                                          pc    
                                                                          a     
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
sse----------cdregrqlqpaerppq--------------------lrpgaptslqtepq-----------------
gkhhrqapgllwd--hqqevptssshhgggawyspswesedsenpsasspqersslaadpattgnpegnhggegdscphg
-e-ashtwv cqiasltddrfrvedsess                 trmaeaa----salfa-slldsvrvvvlswlgqw
v-v masl  af  gqspslrllrrglmp                  ga----rrsm-----lqedqhlpnlkeqearli
pra            ppakkagknqqfed                    vvtsglrevygglheaap ae e  ka  e 
               m  gi dala aa                     mt q hkd gd kd   a             
               c                                  a   eh  ec g                  
                                                      ag   a                    
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------p--------t-spl--------l--rsss--f----drspapmscdkstqtpsppcqafnhylsama--r---
spqgpla-paspgpfa-r---fifmrrss-ls----gy-sfdt---lr-l--gql--l----------------sr-qae
raglrtlrvpfrrryrspprnqllplthgrgwgrrptsqedkatql--t-wssggvm-rcsvtgepqrlfywlvnpleev
g kvtrmattlnpqweplrqetwavqhyccsrvlmkqvlvqsllgtvlkatp--arvrlagssetyvtqwwlprvyksva
   mepe snimafscrana lv ag l yrpkghelp r lkrnaqgaplvrt-ssmaqrwrwlrplispgnprwirrs
   fae  ed a  r              kelfcf dn   gfka i  kfrerthli k cpv l f mg dgllglpr
        d     p                   d ae   c a       a  q h  f am          ciieghl
                                     a                h       g           gfddgi
                                                                          eea d 
                                                                          aa    

       250       260       270       280       290       300       310        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
                                                                              
-a----------------------------------------------------------------------------
p-dmqavlpigeqppegqwqhrpeiriaqelrrigdefnayyarrvflnnyqaaedhpqmvilrllryivrlvwrmhr
vvssp                llpaqrntkwqlyqhrhsrvtwqllskpsssvwwqillflhnla ngeenrngagp 
appp                 wwnvlpfrg dceaeqgrqlqvpqnqqlrnrst                        
tlef                 prlsf cl       h hpdhe  mhedpd                           
sgaa                 eaig   f         ge     he ala                           
gd                     f                     ec  f                            
                                              a                               
                                                                              
                                                                              
© 1998-2019