Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------makqPsdvsse----------cdregrqlqpaerppql
msgvrpisrdtwmetllyeqllepltmevlgvtdpmkpmfqi--fe--eqeesssmtwvrlqs--lglgvslagdglsdc
                                   ieflvpspem- prc-d-adalallcaiaepsddpfrresseaga
                                   ecdgplmrr-g l--v-d         cigmqpsraglrqqaesp
                                      cdghegrd cq pra            dpmkl  knph  pm
                                          adac  a m              c a k    a     
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rpgaptsl-------qtepq----g-hgg------------------------------sp-------------------
gkhhrqapgllwdashqqe-gnpe-n---eglfpldscphgspqgplappaspgpfatr--lfifmrrssllsrsssgyf
qavsslea  aficddlfatptssshlsrlqwysptwecgpglrptsqedketstlgsapasqgvdlpcgvteepqrlfy
vesrmk v       ----islldcprmege    shasei enlsasavearqryspyrqttseaqslpnvvlkel qw
t q lh         ggglhrdvprvf d a    q  r d a  rtrsldtnaqsmrda klql ehae  kg a  lg
s a eg         addd qaal s                    rmm  la hrea   gde  a             
                                               g      ahd    e                  
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----drspapmscdkstqt-psppcqafnhylsamasrr--epadm-p--------------------------------
sfdt---------rrr---p---------r-w--lpa-lqa-----r-eiriaqelrrigdefnayyarrvflnnyqeae
rpgvytlrvtfrrp--sprrrawavgryr-g-rr---p-eesalsslrplsvgtltqmrqsshwqvvwqllwkalsgats
gnamtpeqtvawpewarspgntvwrvqwgysrvwsvqefvdcgvglplrslsqghsvlynrvwstrtlpswsersnssqn
a klrka snimg-svlhnalqqlplnlqtrmpvqivaklvavtaawwnptrnlgqlnpkhhsreiqff nndppl rg 
   gpe  r  dffqq al elgdkfl pqkalshsrwigqvtrrqvhlkhaf ahdilf cmg dle  mh lfd  e 
   fe   l  a  pe  i  f  e h  li knfgnvefhrlpe f igf       aa  g       he d a    
   ea   e     l         a e  ke gl elkddclkk  e fa                    ec        
              c                 ec ciia  iig    a                      a        
              a                     df   gfd                                    

       250       260  
....:....|....:....|..
                      
----------------------
rhpqmvilrllryivrlvwrmh
dngsqpr               
sg pg                 
 a a                  
                      
                      
                      
                      
                      
© 1998-2019