Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------makqpsdvsse----------cdregrqlqpae
msgvrpisrdtwmetllyeqlleplmepsrcveeleddmfqipefepseqed-s----lfaqslldcp-----------s
                         tmevlg tdp e vdppedglsg--pgp-lpadas twv cqilsplqlfplthc
                                      l mmfgvgh-rr--dqdmra           gmspsrarlrq
                                        ik cpd rgcmeca  l             cqakl gkna
                                         c     l ag                    p gk  ae 
                                               a  c                             
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rppqlrpgaptslqtepqgnpegnhg-e-d------pq--l--pa---------------------------------dr
agrgmgaslagdrpsqtg--------g-g-scphgs--gp-ap--spgpfatrsplfifmrrssllsrsssgyfsfdt--
cesspvvtsqeakagdclkharqsp llwpcshtqeqptssshhggnawysrswqsedsenp assveergrssaypatt
slep t qrrlpvldgltqphspaq vmlqagvqegirrlfyanmlg q ep ree       trmpata hrm da kl
qade d a lke gca slvrphvr eafiwdreida lvrrsfde                  gal    ahd a  gd
i a      ea  ea  her m dl   e  aq d   dr mgd d                                  
h                  a f  k                                                       
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
spapmscdkstqtpsppcqafnhylsamasrrqaepa------------rr-----------------------------
-------------------glrtlppp-----e----dmrpeiriaqel--igdefnayyarrvrllssggatqmpqsvi
qedtswrvvvrsrlgqwrl-vpa---nlvrilrtpgpsswlvglygrgwvsypqvlvqvklqlllppnyqaledhrkmss
eqrqhlprrqlkeralypvr---swvlfrpfw-saavntlwnshrnysrqlsshphsestwgspfknlasthvvqlfrnr
 l e aenqkgha   gkspyvqkrt-vpgwspevvtllvrlqflftq khreehqrdrqrpcnaeqfvrstsllhaqcm
   a   ela      a pnmtpimlwimappgvstleaeaia   l  dcmaaa i llkaamsdkth q h ia   g
                  gl elefgt lvkifqrnga   f    k    h      gfe  ihadpd l         
                   k aed e  inegdhq e    a    g    f      da   ee a             
                       a    glae di d         f           c     c               
                            ci d c  c                                           
                               a                                                

       250       260        
....:....|....:....|....:...
                            
----------------------------
lrllryivrlvwrmhlsseqsrngpgpr
wtvwwqswwfrnnlrgngapnqg a   
n rvf  lldlhlga    ee       
g                           
                            
                            
                            
                            
                            
                            
© 1998-2018