Dataset for protein classical BH3-containing proteins of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------makqpsdvsse----------cdregrqlqpaerppqlrpgaptsl
mepsrcvemfqipefepseqedsssaerglgpslagdr-------hrqapgllqiwgcshsrerltssshhgga---sas
        eleddviqredgmpgaqpgsspsaltf--- pqcgkhasatwv v  l-aplqlalkfpltscc--alrptv
         sgvrp s dtw etlly qlfevds-rqs ca pra       c  - vtppk garqqles-vtswygpp
                           mk c ghrerg                   pqdke d namedpptgqrlle 
                           ic       ac                   m ag    e haafm    ek  
                                                                 d           d  
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qtepqgnpegnhg---------s-q-p--p--------------------------------f-tdrspapmscdkstqt
eerkh--------gegdscphg-p-g-la-paspgpfatrsplfifmrrssllsrsssgyfs-d---------------r
wcdedsqtlaarlpsqgvmldcgvteepqallgeaqyhsprlwaaqrytvkirrlpvtfapgvyrlpvvrsrprvlqrr-
ggstatdapspkseciqwerpa lrvsrsrtflrvrserlnqe  cdqnre kpvlreyvdaptks tqtvpwtttgygq
admstqssypvata e dqmev apmrvpsqd qsam p g a     gdd  dmgl wrnrgpgp rlktlvnrrrwwp
  glrlrrf lgm     le i mellam fr n  h e              a  d  m  ek a l  gfrliqpmse
  ag hend d       aa e   a  l e                            g   e   a  dagghmaih 
      am                    g d                                a        eae  f  
                                                                          a     
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
psppcqafnhylsamasrrqaepa--------------------------------------------------------
sp----w-r-----l--kl---a-dmrpeiriaqelrrigdefnayyarrvflpnyqaardhpqmvilrllryivrlvwr
--swrgly-twwvl-vragsvl-lssgglhvrqtrqnlyrvwwsillhqlnsknlsestesgagpr              
rqnefv-vssprpwtlg-aecigdqvwwntqqplqcm n sslrqdtflhlqwlpgsqnsn                   
qcfctsvrqrkqlrnsaw-lsavvlflrfsllnkg d   hhhq a e emledfecle g                   
kaaaqrnqpqimgqipvqtglv teahl gf lh                 ha  d e                      
a   pe lkleedp inpifhs sa e     ff                 e   a                        
    ga chaa  n gllh er p                           a                            
       a       diie dm                                                          
               cefd                                                             
                 e                                                              

  
..
  
--
mh
  
  
  
  
  
  
  
  
  
© 1998-2019