Dataset for protein Bad of organism Cercocebus atys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************************************************************    ..       .  .
MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQPTSSSHHGGt---ssveersrsssys
                                                               gawygpswtsghhenpp
                                                               a    ap   ed dada

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*    : .      .  . .               :*. :   :       *            ..       .      
Artqldasmrvsvsstrgrs--a------------kLrrlsv-fvpsvktpPtptvrvtttgyrrsssptrvfr------
 kmleeeglpmlpppflsqgrs-ppnlwaaqrynve kpmpltwrdrpegl rlrslrrhlqwgqkpfwqglcqswwprt
 glea   aeeeagaed eaqh e         gr   a gde a gfa a a kgaggak m   ca faaakaprdpn

       170       180  
....:....|....:....|..
  . *  . .            
-grgSvmpss-gg---------
s-qh slalqv--ltqipfrcm
    a a s           
© 1998-2018