Dataset for protein classical BH3-containing proteins of organism Cavia porcellus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                               shpse-----r----q-p--- ---------e-
                                                fmr ak  a dpmm t-l   spq lsssgar
                                                  g         lf i e   p   dlaee l

        90       100       110       120       130       140       150       160
g-t-----egngss edagdrs hgspq  lap a pg                         nlmmpshvsssvqsrrt
-vgqspwgdel  p g t                                               gecgeqqrqaalnla
   pp t  d     a g                                                    gckl      

       170       180       190       200       210       220       230       240
rhelevdlrtrsrrvsytpnslvhtteitevqmgmwgvlspltsrsrsa drlelcvrcaae --m- -l-fqfkgl---
ha gtma elqlphrgqpl r  cs aalyeleeleekkg ksleldp    a   g         s k vd     prp
c  d    a     ladla            ea  a e a frg  a                                 

       250       260       270       280       290       
                                  . :                    
---g-----wvs---                    k qs---r-----tsapsqesv
ksa t trl  nsr                     a mqwwsknisrvg        
      ska   pn                         l d l glg         
© 1998-2019