Dataset for protein Bmf of organism Cavia porcellus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    ****************************
-------------------------------------------------p-eMEPPQCVEELEDDVFQPEDGEPGTQPGS
mpgagvfwkqyrarrrrrgpdpprvfvtldpgtepwhhdseadslswvh-r-                            
                                               sf g                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPA
                                                                                
                                                                                

       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
****************************************************************************
SFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRNRAWWQVLLFMHNLGLNGEENREGAGPR
                                                                            
                                                                            
© 1998-2018