Dataset for protein Bim of organism Cavia porcellus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSCECDREGGQLQPAERPSQLRAGAPTSLQTEPQgnpegagdrsphgspqgplappaspgpfatrsplfifvr
                                         ---------------------------------------

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 ***************************************************************
rssllsrsssgyfsfdtDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAGPPHLRPEIWIAQELRRIGDEFNAS
-----------------                                                               

       170       180       190      
....:....|....:....|....:....|....:.
************************************
YPRRVFLNHYQPAEDQPQMVILRLLRYIIRLVWRMH
                                    
© 1998-2018