Dataset for protein Puma of organism Castor canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                          **********************
----------------------------------------------------------MARARQEGSSPEPVEGLARDGP
mklsvgaaracscqvprvascgwahalfvwslarcaqsgvcpasgpvsrnlsqapgsa                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
RPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAQQ
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
HLESPVPSVPEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQQHRPSPWRVLYNVIMGLLPLP
                                                                                

       250 
....:....|.
***********
RGPGAPEMEPN
           
© 1998-2019