Dataset for protein classical BH3-containing proteins of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------pqecsspldrgvgqpqpgerppqlrpllstal--
mgtpenpsaapttrklsirrrrresggrqyrgwrqsmfqipemaqs--qvveecederfpspdappgagpsrgvpss-gl
                             waapag       femqesdd-m arpdlrsletsdtsvprtkhaladv  
                                            kerp--pc -h vg larvcacrf algewegep  
                                            ra  mg   g  ae   a        d  r c i  
                                                                             a  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------q--------------------------------------------------------d--p-t-s---rsqgp
lgeqtqs-gqplgsplsrpqlfplthlcgpglrptsqersplprwvrrssllsrsssgyfsfdt-rs-q-m-vet-----
   fghrcepgadcgprclags qgycap tspgpvttalgafif                   skhtgplapdsstrtv
   aaeq  n epeadaa   l aap  a aa  afaa                          phagasgpcakppdhs
   scgl      a                                                   gg r r rgp     
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        *. :.*.::               
sppcgp-e------ylta-----lg--ag-pa-appg-------waaq------reLrrigDefhaly---pr---vrtq
------t-hpqrlfegsepvmys--qs--v--s----lqppegq----aeirig-q qcma qlnvyhkgl--rvsmqqh
mysaqvfne     --n-  germrpprsrsrgtrlnirge e  qhr   qyaak kals k  rsfmwrr prfagha
ql lsaedd     q -s  eadpplfqaf tdla ee       ire       r      d  qrt   e akq----
      a q     h e   psa  al  g  q    v                           f q        rerp
                                                                            e a 

       250       260       270       
....:....|....:....|....:....|....:..
                                     
aqnrqpqwwlrllqlylvr-----llgrgn-------
timgnspsvtlrvlswnsaalaawnvwdrgsnpsqpr
q-e-hrmm-qifcfrhqlp     fnrsmqragag n
-p-p---- --n vnliak      p getlpeve  
rhras wy pyk iag              a      
  g l tr  w  a a                     
© 1998-2019