Dataset for protein Bad of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                           * **    ***********************************:      ***
--------------------------yRqWA---qSMFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLt------PGL
mgtpenpsaapttrklsirrrrresgg a  gprg                                   skhwlta   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHV
                                                                                

       170       180       190       200    
....:....|....:....|....:....|....:....|....
********************************************
SFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ
                                            
© 1998-2019