Dataset for protein classical BH3-containing proteins of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------fq-----e-ep--qp-s-----------------r--
matprqpssspeqvpgtrrsgtrrrplsrpvpvscscplersm--stfpp-f--sl-eg-ylsaqtfqqsvtespgn-lh
  raeneg a apde lakd pepfmkkqmsttqvvggtsqpvlp   iaprp qel-daptclpleppgqpdglasp  
                         ea clldscsleercgnq l   lqdhg gvr vpl   d aa anlacelg   
                             ae pahead aegl     ae ga et  a              a  d   
                                m       ddg        a  a                         
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      *      .                                                  
----------gl---------gPsptgdrppspgkhqqtspgl-s-ag-----pa-r---ggag-et---------fp--
lfplthccpq--pqgpryypps gsrarkstq--a-rapell-r-s--hqqgq--s-lhh----a--rwpsprhss--ag
        gprwtglvlsrdrr trqstqaslvp-v---a--vlgesayltfdvtqskayvsgeysvwtmlspvqelnhy
           s d  eapcam rhnepn d-tlstsss-spsplpp vts gtprapppmrddmrqq    lpga    
           m      m  c l k ng aasipparlrqa m ac qfa eedm afginc k l      ca     
                         f      fcfe hg e       a          f    e               
                         d         c                                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                .  :  :.                                        
----------------------------er-igrelrrmgdef-----------------------------------r-
tdedegmeeeelspfrgrsssappnlraa-r-aaqmyslaftlnqgsfkglprpksagtatqmrqsrswtrviqswyd-r
lsamas r      lleqpqevqwqmcp-vey qr qkis qy htglr vl srlhmqqnlrnnnpv wqltnalwqln
                   pag adh   iwc mk kcf  k            f d l h qe i i sfillryhp t
                              q  ia  a   d                               ff  n a
                                                                             e  
                                                                                

       250       260       270       280   
....:....|....:....|....:....|....:....|...
                                           
l----nrggsapsq-l---ll-ll--l---g------------
-wrrrg--rp---rv-vpt--r--vl-vgs-lrlmwpngrrnl
vqlnq-qv--shw-riylsiwpyisrqrwrlapelqll     
rneeny ssrn ppqfrqrysnwgpqplrwctlaae       
mfadeq naeg gfnalnl mls ckafqvaq           
     a h a  a m i k  g  aa dc              
       a      g   g  c     a               
© 1998-2018