Dataset for protein classical BH3-containing proteins of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------makqpsdvssec--dregrqlqpaerpp------qlrpgaptslqtepqgnpegnhggegdsclhg
mkcgvgsamfqipe------mep-saveelgldpstagdge-gsgkhrrtv--slgdadlqqg-----------------
        wsevrqfepseq---vq-  ---dsvfsse---qhveacsgqqlsl-l--shfa-qstsssrhnsnqwvrld
         acpcpvssdsfedwlp   qqf--arkr-rps alc   --ag -r-eea---verlpevmeegeplsetr
              lprai s tc-   mpcvp phmsqa        sv-   dsa -qlttadal c    dgaa ql
                      m l    m kk   l l         ep     p   gg a a k      aa   mi
                                                ag          d                 ef
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
spqg-----plappaspgpfatr--sp-----r--s---r--sg------yfsfdtdrspapmscdkstqtpsppcqa--
----rlqsf--------------my--lfifv-rs-vls-ss--vvdvfr------rkatqtlvpasps-rvrlgtlvte
crlsdqmlysathcelqqlyevs  leglglwlsrvatpnvwqa     qrygrql------rrverarsl-mfwsgln 
gkilag dvrrrascgnhtrprp    fra   pgtdpgdtpa      anrtkeevqrwrwfqsvqwvrgrqavrvg  
acha    a  mtrrdeamenek    a     d   ia ll        alqegwh msms grsfkqh-kh klsp  
 aa        gdedaa     a                              d ia l de eegc kga a  dk   
             d                                               d  d          aa   
                                                                a               
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------fnhylsamasmrqsqae-----------------------------------------------
epqrlfygpagyrlplyaswmlvlp----higppagmrpeiwiaqelrrigdefnayyprrvnwnlpqcwrkhvcleafp
       an e     pwtqvaqsvyglagpq-ewrwnvrvqwfrqeqggnsstwttqvstrfliryfrhwqeplmvinr
                trqlpvngsvwtt---wqlqrkrltitekn gcvhpqqsrlhqqqltswpsrmnsivlhflhll
                qlpk rla-rvprvvvvlsppfnfgfgdfk e hahhphqefkhkisqsnnaeaed        
                lkli g  iqrimqsltkmlh a      d c    a ge     hqkl e a           
                 hah c  gppglprfsi e                         deh  d             
                   f    fllegllelc                                              
                   a     fkafea g                                               
                          i ed  f                                               
                          e  c  d                                               

       250       260       270       280       290       300       310      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
                                                                            
----------------------------------------------------------------------------
vlpskasqsaywttirdrsintccakaqriisgnilqsvarwcqmmltpqlylvlkdggpvvksalklpwfhspva
l ryivrrvwrrpr                                                              
a ngeenlnggmhe                                                              
          ag                                                                
                                                                            
                                                                            
                                                                            
                                                                            
                                                                            
                                                                            
© 1998-2018