Dataset for protein Bmf of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************. *      * *. .. *     *  :*.                             *:. *
GVMLPCGVTEEPQRLFYgpAg-----PkShvvvlPplpqqPggqWr-----------------------------RnrmW
                 an eyrlpl a fpaag lgeap efe qhraevqiarklqciadqfhrlhvqqhqqn eqe 

       170       180    
....:....|....:....|....
                    . * 
--------------------grPr
wqvllflhnlalngeenrngag e
© 1998-2018