Dataset for protein Bim of organism Callithrix jacchus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQgnpegnhggegdsclhgspqgplappaspgpfatrsplf
                                         ---------------------------------------
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     ******************************                             
ifvrrssvlsrsssgyfsfdtDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMasmrqsqaepagmrpeiwiaqelrrigde
---------------------                              v----tivv--------------------
                                                   -vyimgvqqislwfrftftpwkvcghhhs
                                                   gri leggd c       lffd     ek
                                                     e ed f                     
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------fnayyprr---------------------------------------------------------------
qgtrvqpkt--------vnwllpfchrkevcleafpvlpskasqsaywttirdrsintccakaqriisgnilqsvarwcq
 eeeqnhhdwswfkst tslisyrnsihpphmvilrl ryivrlvwrmh                               
          et     lhsnpdqaaedh                                                   
                 ifk na                                                         
                  e                                                             

       250       260       270  
....:....|....:....|....:....|..
                                
--------------------------------
mmltpqlylvlkdggpvvksalklpwfhspva
                                
                                
                                
                                
© 1998-2018