Dataset for protein classical BH3-containing proteins of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                     .  ..  :   .   . :  *        :.  :         
--------------------------------makqpsdvssecdreggqlqpadrpPglrp--lgaptllqterq--p-
mplsvrsylwiwlgspgaglgdlapimfqipe----mqppqcveelgldvsptgege qtskrw-tsagsfgqsqlqq-q
                          rrkkdqfeqseeed  ra   d pf  e      q hs l   aeaghdcgl
                                                                          gn e

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    ..   . :  . :.     .   :    
--g-------------------------------------------------drspatmscdkssqtpsppcgafn----
sr-slfplthccgpglrptsqepfatrsplfifvrrssllsrsssgyfsfdtskhtqplavetrtrhvmyraqvteepqr
palqrc qgspq  lap a pg                               hagg g pasp  gs l   ped    
ge d                                                                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .   .:        ..    *  .       :*. :.*:*:  .                :       : 
-------hylsamasmrqsqavpadtppeiWiaq------reLrrigDeFhayy---prrvfvrhqaveghpqmvllrvl
lfyghagyretlpedlppgrprsrsprenq qhraeiryg-k qcms q nvshkgl-------tatyqrqspswwwqlq
       ne pee  fgaflglgeqa  gl     qia      a    rlf     pksagm qqmqnrnrmtrfi 
                                                                   e            

       250       260
....:....|....:....|
 :: .   .           
rylvrlvwrgq---------
swisnvllnmgsnrsqagpr
lh nag  deapng    
                    
© 1998-2019